Crown Peptides

Immunology Research Peptides

LL-37 Research Peptide

A high-purity research peptide studied in immune and antimicrobial research. Available in 5mg, with every batch independently tested and dispatched from the UK.

£34.99
From: £34.99
Your selection:
Batch level verified
All Batches TestedEvery batch, no exceptions
HPLC & MS VerifiedFull certificate published
Same Day PostageOrder before 2pm
UK Based CompanyDispatched from the UK
Product Overview

A high-purity research peptide studied in immune and antimicrobial research. Available in 5mg, with every batch independently tested and dispatched from the UK.

Full Product Specification
Overview

Product Overview

LL-37 peptide UK is Crown Peptides' human cathelicidin-derived 37-amino-acid antimicrobial peptide, available in 5mg strength for laboratory research.

5mgAvailable strengthHPLC testedChromatographic purityMS verifiedIdentity confirmedBatch CoADocumentation supplied

Supplied for laboratory research purposes only — not for human consumption or for medical, veterinary or diagnostic use.

Key features

Key Features

  • Studied in research involving antimicrobial peptide activity
  • Studied in research involving biofilm and membrane-interaction research
  • Studied in research involving innate immune signalling
  • Studied in research involving host-defence and inflammatory pathways
  • Batch-specific quality documentation available
Background

About LL-37 Peptide UK

LL-37 is a 37-amino-acid cationic peptide generated from the human cathelicidin precursor hCAP18. It is an important research molecule in innate immunity because it combines direct antimicrobial activity with effects on host-cell signalling.

Research

LL-37 Research

LL-37 has been extensively investigated in antimicrobial assays, biofilm models, membrane interactions, innate immune signalling, inflammatory responses and wound-related research, with pleiotropic activity documented across this literature (Learn more). Its amphipathic cationic structure allows interaction with microbial membranes, while separate research examines chemotactic, immune-modulatory and epithelial signalling functions, alongside related host-defence and barrier-research peptides such as [KPV].

  • Antimicrobial peptide activity
  • Biofilm and membrane-interaction research
  • Innate immune signalling
  • Host-defence and inflammatory pathways
Specifications

Specifications

Product
LL-37
Classification
Human cathelicidin-derived 37-amino-acid antimicrobial peptide
Available strength
5mg
CAS number
154947-66-7
Molecular weight
4493.3 g/mol
Molecular formula
C205H340N60O53
Sequence
[LL-37, 37 aa]
Form
Research material supplied according to product label
Purity and assay
99% (HPLC), batch-specific — refer to Certificate of Analysis
Verification
HPLC and Mass Spectrometry where analytically appropriate

Compound-level reference data. Batch-specific results appear on the Certificate of Analysis.

Work out concentration with the peptide calculator
Testing

Purity and Testing

Crown Peptides LL-37 is supplied for controlled laboratory research with batch-specific analytical documentation. High-Performance Liquid Chromatography (HPLC) can assess chromatographic purity, while Mass Spectrometry provides molecular information used to support identity verification.

The batch-specific Certificate of Analysis is the definitive source for the exact purity result, identity data and analytical specification of the material supplied.

Storage

Storage Conditions

  • Store unreconstituted material at -20°C ± 5°C in a cool, dry environment
  • Prepared research solutions should use validated storage conditions appropriate to the compound and study design
  • Protect from unnecessary heat, direct light and repeated temperature fluctuations
Full storage guide
Related

Related Compounds

Researchers working with LL-37 may also be interested in [KPV], [BPC-157], [Thymosin Alpha-1], [VIP] and [GHK-Cu] — other compounds studied in host-defence, immune and barrier-related research.

Compliance

Research Use Only

  • Laboratory research only
  • Not for human or clinical use
  • Not for human or veterinary consumption
  • Qualified personnel only
Questions

LL-37 Frequently Asked Questions

What is LL-37?

LL-37 is a 37-amino-acid cationic antimicrobial peptide produced from the human cathelicidin precursor hCAP18, supplied by Crown Peptides at 5mg strength.

What is LL-37 researched for?

Research includes antimicrobial activity, biofilms, membrane interactions, innate immunity, inflammatory signalling and epithelial responses.

Why is LL-37 called an antimicrobial peptide?

Its cationic amphipathic structure allows it to interact with microbial membranes in experimental systems.

Does LL-37 only have antimicrobial research applications?

No. It is also studied in chemotaxis, immune signalling, inflammation and wound-related cellular models.

How is LL-37 identity verified?

Peptide identity and purity can be assessed using Mass Spectrometry and HPLC, with the exact sequence/form and results documented for the batch.

Read the batch certificate before you order

Every batch is published openly — identity, purity and batch number, with no account needed.

View lab reports

Supplied for laboratory research purposes only — not for human consumption or for medical, veterinary or diagnostic use.

All Batches Purity Tested

Each batch undergoes internal analytical verification using chromatographic and spectrometric methods prior to lyophilisation.

• HPLC Analysis
• Mass Spectrometry Confirmation
• Batch Traceability

For Research Use Only

By purchasing this product you confirm that you are a qualified researcher and that this compound will be used exclusively for laboratory research purposes.

Not for Human Consumption

This product is not intended for diagnostic or therapeutic use.

Any human or medical use is strictly prohibited.

Store Safely at All Times

Store in a cool, dry, secure and sterile environment away from any unauthorised persons or children.

Other Research Peptides

5-Amino-1MQ research compound UK 10mg and 50mg vial - Crown Peptides
≥99% PURITY
HPLC & MS TESTED
5-Amino-1MQ Research Compound
From: £24.99

Buy Now

AHK-Cu 100mg research peptide vial – Crown Peptides UK
≥99% PURITY
HPLC & MS TESTED
AHK-Cu Research Peptide
From: £29.99

Buy Now

AOD-9604
≥99% PURITY
HPLC & MS TESTED
AOD-9604 Research Peptide
From: £34.99

Buy Now

ARA-290 research peptide UK 10mg vial - Crown Peptides
≥99% PURITY
HPLC & MS TESTED
ARA-290 Research Peptide
From: £39.99

Buy Now

Completed Orders
0 +
VERIFIED PURITY
0 +%
UK Research Supplier
No. 0
ORDER DISPATCH
0 hr

Further reading

SUPPORT Mon to Fri, 9am to 5pmDISPATCH Cut-off 2pmEMAIL Info@crownpeptides.co.ukWHATSAPP +44 7301 802654

Disclaimer: All products are sold strictly for laboratory research purposes only. Not for human or veterinary use, consumption, therapeutic, or diagnostic application. By purchasing, you confirm you are a qualified professional and legally permitted to handle these materials in compliance with all applicable laws and regulations. Misuse, resale for unauthorised purposes, or unlawful application is strictly prohibited. Crown Peptides UK disclaims all liability for improper use, handling, or regulatory non-compliance.

© 2026 Crown Peptides UK, a trading name of Crown Peptides Ltd (company no. 17068950), Suite Ra01, 195-197 Wood Street, London E17 3NU . All Rights Reserved.